Skip to Content

ELISA Recombinant Pseudomonas aeruginosa Electron transport complex protein RnfE(rnfE)

https://www.anagnostics.com/web/image/product.template/150846/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9HYB5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEQDFREIARNGLWRNNPGLVQLLGLCPLLGTSNSTVNALGLGLATmLVLACSNAAVSL VRGAVSEAIRLPAFVMIIAVLTTCIELLMQAWTYELYQVLGIFIPLITTNCVILGRAEAF AAKNGVLRASFDGLLMGLGFALVLLVLGGLRELLGQGTLLADMHLLFGPAAADWKIQPFP QYQGFLLAILPPGAFImLGLLIALKNRIDESLAERAKVQAGDVPATQRQRQRVRVTGVIE Protein Names:Recommended name: Electron transport complex protein RnfE Gene Names:Name:rnfE Ordered Locus Names:PA3494 Expression Region:1-240 Sequence Info:fµLl length protein

1,588.00 € 1588.0 EUR 1,588.00 €

1,588.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.