ELISA Recombinant Rat Taste receptor type 2 member 110(Tas2r110)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9JKE8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFLHTIKQRDIFTLIIIFFVEITMGILGNGFIALVNIVDWIKRRRISSVDKILTTLALTR LIYAWSmLIFILLFILGPHLIMRSEILTSMGVIWVVNNHFSIWLATCLGVFYFLKIANFS NSLFLYLKWRVKKVVLMIIVVSLIFLILNIFSLEIYDHFSIDVYEGNMSYSLGDSTHFPR IFLFANSSKVFLITNSSQVFLPINSLFmLIPFTVSLVAFFmLIFSLWKHHKKMEVNAKGP RDASTTAHIKALQTGLSFLLLYAIYLLFIVIGILSHKFMGGKLILIFDHICAIVFPISHS FVLILGNSKLRRSTLSVLRFLRCRSKHIHIMDP Protein Names:Recommended name: Taste receptor type 2 member 110 Short name= T2R110 Alternative name(s): Taste receptor type 2 member 10 Short name= T2R10 Gene Names:Name:Tas2r110 Synonyms:Tas2r10 Expression Region:1-333 Sequence Info:fµLl length protein