ELISA Recombinant Schizosaccharomyces pombe Fe(2+)-Mn(2+) transporter pcl1(pcl1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9P6J2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWSIFEARPKEAHSVNKIGWLRASVLGANDGILSLSGLLVGVVAANADIKVILITGVAGL MSGALSMAVGEYVSVSSQADLEDADLQLERREMDADWDAEVDELAAIYRGRGLDEELSRT VAVQLMEYNALEAHARDELGINIHTTAKPTLAALSSAASFSVGGIFPLLTSLITPLEYLS LVLPIATMFFLGmLGFVGAHIGGAKRVRAILRAVVLGLLAMAATALVGRLLEIHALSLQY AI Protein Names:Recommended name: Fe(2+)/Mn(2+) transporter pcl1 Alternative name(s): Pombe ccc1-like protein 1 Gene Names:Name:pcl1 ORF Names:SPBC1683.10c Expression Region:1-242 Sequence Info:fµLl length protein