ELISA Recombinant Schizosaccharomyces pombe Protein YIP4(SPAC644.13c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9P6P8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTDIGKHNTEIEQDEMENLLRMDPVRSSLDVESRAIEPDNIAGESIVETRFTGGDSLDEP IRVTLFNEFRAIGEKLVYVLYPKNAQVLRDWDLWGPLIFSLVIALALALSTDKIERESVF TVVVALIWFGEAVCSLNIKLLGANISIFQSMCILGYSSFPLMIASIVCAFVPLIFIRIPV IVAMYAWTLFAAMGVLQNSNLSNKKLLAVYPLFLFYFSLAWIIFL Protein Names:Recommended name: Protein YIP4 Alternative name(s): YPT-interacting protein 4 Gene Names:ORF Names:SPAC644.13c Expression Region:1-225 Sequence Info:fµLl length protein