ELISA Recombinant Rat CD151 antigen(Cd151)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9QZA6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMIKRYHQSGHEGVTNAVDKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVV PDSCCKTVVTGCGKREHASNIYKVEGGCITKLESFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY Protein Names:Recommended name: CD151 antigen Alternative name(s): Platelet-endothelial tetraspan antigen 3 Short name= PETA-3 CD_antigen= CD151 Gene Names:Name:Cd151 Synonyms:Peta3 Expression Region:1-253 Sequence Info:fµLl length protein