ELISA Recombinant Volvox carteri Cytochrome b6-f complex subunit petO, chloroplastic(PETO)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Volvox carteri (Green alga) Uniprot NO.:Q9SBM5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GVVLQQPELKKVFQDDAPAPAPVKREFKGLAPPSLPKPVEAPKPAAVAAAPEKKEEVKES GSDLDPRSIALPGALALTIGGFFAASKIDTSFNEWFIEAVVKDSNNYAGYEATLKTDAGV VFPKAATAGTKKVKAATGSKKGGFPFGGKK Protein Names:Recommended name: Cytochrome b6-f complex subunit petO, chloroplastic Alternative name(s): Cytochrome b6-f complex subunit V Short name= suV Cytochrome b6-f-associated phosphoprotein Gene Names:Name:PETO Expression Region:54-203 Sequence Info:fµLl length protein