ELISA Recombinant Tortula ruralis Photosystem I reaction center subunit V, chloroplastic(PSAG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:TortµLa ruralis (Star moss) (Twisted moss) Uniprot NO.:Q9SPM4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ANTSFIISASTAALLALGRFVFLPFQRSMVSRHGLPEQNGVPTTRRVTAVRRRWWSmLKT NDPAGFTLVDVLAWGALGHAVGFFILATATNGYNGFQ Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): PSI-G Gene Names:Name:PSAG Expression Region:16-112 Sequence Info:fµLl length protein