ELISA Recombinant Sheep Adrenocorticotropic hormone receptor(MC2R)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ovis aries (Sheep) Uniprot NO.:Q9TU77 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRHILNLYENINSTARNNSDCPAVILPEEIFFTVSIVGVLENLMVLLAVAKNKSLQSPMY FFICSLAISDmLGSLYKILENVLIMFRNMGYLEPRGSFESTADDVVDSLFILSLLGSICS LSVIAADRYITIFHALQYHSIVTMHRALVVLTVLWAGCTGSGITIVTFSHHVPTVIAFTA LFPLmLAFILCLYVHMFLLARSHARRTSSLPKANMRGAITLTVLLGVFIFCWAPFVLHVL LMTFCPADPYCACYMSLFQVNGVLIMCNAVIDPFIYAFRSPELRVAFKKMVICNW Protein Names:Recommended name: Adrenocorticotropic hormone receptor Short name= ACTH receptor Short name= ACTH-R Alternative name(s): Adrenocorticotropin receptor Melanocortin receptor 2 Short name= MC2-R Gene Names:Name:MC2R Expression Region:1-295 Sequence Info:fµLl length protein