ELISA Recombinant Schizosaccharomyces pombe Rsm22-cox11 tandem protein 1, mitochondrial(cox1101)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9UTM2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TTIYYLVAISIFALGLTYAAVPLYRLFCSKTGYGGTLNTDQSRMNAERMVPRKDNKRIRV TFNGDVAGNLSWKLWPQQREIYVLPGETALGFYTAENTSDHDIVGVATYNIVPGQAAVYF SKVACFCFEEQKLDAHEKVDLPVFFFIDPEFADDPNMKDIDDILLSYTFFEARYDTNGNL LTKLN Protein Names:Recommended name: Rsm22-cox11 tandem protein 1, mitochondrial Cleaved into the following 2 chains: 1. 37S ribosomal protein S22-1 EC= 2. 2.1.1.- 3. Cytochrome c oxidase assembly protein cox11-1 Gene Names:Name:cox1101 Synonyms:cox11, cox11-a ORF Names:SPAC1420.04c, SPAPB17E12.01c Expression Region:569-753 Sequence Info:fµLl length protein