ELISA Recombinant Pyrococcus abyssi UPF0290 protein PYRAB16220(PYRAB16220)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrococcus abyssi (strain GE5 / Orsay) Uniprot NO.:Q9UY86 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPIFEAFWYILPAYFANSSPVVLGGGTPIDFGKKWRDGRRIFGDGKTWRGFFGGITVGT VVGTIQHLMFPGYYGSLKLAVGVAFLLSLGALVGDLIGSFIKRRLNMPRGYPAVGLDQWG FLISALCFAYPLRTIPTGEVLFLLVVTPVIHWLANVFAYRMKWKNVPW Protein Names:Recommended name: UPF0290 protein PYRAB16220 Gene Names:Ordered Locus Names:PYRAB16220 ORF Names:PAB1285 Expression Region:1-168 Sequence Info:fµLl length protein