ELISA Recombinant Schizosaccharomyces pombe Signal peptidase complex subunit spc2(spc2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9UTQ9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPKYNVSDFKSKFDKELTNHFNKNGYKQSFVFEDIRLLIAIACIIPAGLAFGIEYVYGFG VLKSYLKYLLPLYFLASCLLTFWSSVVKGSTVYVATKKERHIKISADTFLPLKNKPLITT KFTVLKNRNAVQLEWSVPVAHIFEEDGQISSATFEAEISKYLSQIEN Protein Names:Recommended name: Signal peptidase complex subunit spc2 Alternative name(s): Microsomal signal peptidase subunit 2 Gene Names:Name:spc2 ORF Names:SPAC1071.04c Expression Region:1-167 Sequence Info:fµLl length protein