ELISA Recombinant Schizosaccharomyces pombe Putative elongation of fatty acids protein 1(SPAC1B2.03c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9UTF7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLTGAHmLKIHRPSIDHPFGVDLWHLFEQLSIKTIGWNPSEFEYIPGKTPMSQWSSVIV SITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVFRNYMRNGLF YCVCDSRHFTQRLVTLYYLNYLTKYLELMDTVFLFLKKKPLAFLHCYHHGITALLCFTQL LGRTSVQWGVIGLNLYVHVIMYSYYFLAACGRRVWWKQWVTRVQIIQFVLDLILCYFGTY SHIAFRYFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYINTYIKRGAKKNQRKAAG KADNTSVAAAAGSEALAATTATNASPFSARSRKL Protein Names:Recommended name: Putative elongation of fatty acids protein 1 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase SPAC1B2.03c Gene Names:ORF Names:SPAC1B2.03c Expression Region:1-334 Sequence Info:fµLl length protein