ELISA Recombinant Schizosaccharomyces pombe V-type proton ATPase 16 kDa proteolipid subunit 2(vma11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9URZ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSNLCPIYSSFFGFAGVCASMVFSCLGAGYGTALAGRGIAAVGAFRPEIVMKSLIPVVM SGIIGVYGLVMSVLIAGDMSPDNDYSLFSGFIHLSAGLAVGLTGVAAGYAIGVVGDRGVQ SFMRQDRIFVSMVLILIFAEVLGLYGLIVGLILQTKTSNVCY Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2 Short name= V-ATPase 16 kDa proteolipid subunit 2 Alternative name(s): Proteolipid protein vma11 Vacuolar proton pump 16 kDa proteolipid subunit 2 Gene Names:Name:vma11 ORF Names:SPAC732.01 Expression Region:1-162 Sequence Info:fµLl length protein