ELISA Recombinant Schizosaccharomyces pombe Syntaxin-like protein psy1(psy1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9USH7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKANDYTLGVEMIPLSMGEFFEEIDHIRDAIRQIEDNVGRIEmLHQQSLQEIDEANIAA TTRHLEGYTSDTRRLQTSVQLAIRSLESQNMQLPPDNDTATRKTQTEAVKKKFMDQIRHF LQIEKTYRAQYEQRMRRQLEIANPRATEDDFQTAINEENGGQVFAQALLRSNRSGEARTA LREVQERHADIKRIERTIAELAQLFQDMATMVQEQEPMVDKIVTDAVNVRTNMGEGTQHM DRAIKSARAARKKKWICFGICVVIICVIVAVLCGVLIPVLGNRH Protein Names:Recommended name: Syntaxin-like protein psy1 Gene Names:Name:psy1 Synonyms:sso1 ORF Names:SPCC825.03c Expression Region:1-284 Sequence Info:fµLl length protein