ELISA Recombinant Schizosaccharomyces pombe Protein YIP5(yip5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9UTD3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAHEIEIDSEADLGRTTFEAEDLYKQRTPITKPPAPRLQSRRASMQETPWTIKDSFNVET KDVVQRCIHTLIPTVNFFDVVDDRPDLYGPFWITTTVIQALFFSNSITEYARYATGHGTS GYSIKKLISAASIIYGYTTIIAVLLWGILVWNKCNPKLLDCLCLYGYANIVWLPVSLATP PFGLLSTLASHIVKYVLTGIGLLISIVFLTRNLYPICQQAGSNLCKLLLFGIIVFHCLLA LSLQLIFFS Protein Names:Recommended name: Protein YIP5 Alternative name(s): YPT-interacting protein 5 Gene Names:Name:yip5 ORF Names:SPAC227.06 Expression Region:1-249 Sequence Info:fµLl length protein