ELISA Recombinant Pyrococcus abyssi Molybdate-tungstate transport system permease protein wtpB(wtpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pyrococcus abyssi (strain GE5 / Orsay) Uniprot NO.:Q9V2C1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGGRDYTLYLFAALGSFLIVYIALPIIVIFTKQALDFRmLVKTIHDPLVIEALRNSLLTA TATALISLLFGVPLGYVLARKDFRGKSLVQAIIDVPIVIPHSVVGImLLVTFSNAILDSY KGIIAAmLFVSAPFAINSARDGFLAVDEKLEHVARTLGASKLRTFFSISLPIALPSIASG AIMAWARGISEVGAILIVAYYPKTAQVLVMEYFNNYGLRASRPISVILMGISLGIFVVLR WLIGKAKS Protein Names:Recommended name: Molybdate/tungstate transport system permease protein wtpB Gene Names:Name:wtpB Ordered Locus Names:PYRAB01530 ORF Names:PAB0102 Expression Region:1-248 Sequence Info:fµLl length protein