Skip to Content

ELISA Recombinant Satsuma dwarf virus RNA1 polyprotein

https://www.anagnostics.com/web/image/product.template/156074/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Satsuma dwarf virus (isolate Satsuma mandarin/Japan/S-58/1977) (SDV) Uniprot NO.:Q9WAL8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AELDAAILDRFSIPISECRKELTPMTTRLGYVVGQYPRALRKTSIVPSIIHDNLWRKPET EPTILGKIDDRSPFPYDPYATIGEKFVQEVGPIDLSVGSDASLVVANIGSSWKAVGKPQC PTVLTWEVAINGDAAIPYCERLPLSTSEGYPDSIQRNFGEKGKKRFFDLKGENVRVPTPA LMEELEVLERELQKEEVCLTCINTACAKDEKTAPKKVRVQPKTRIFEILPFQINIIIRRY LMFWMQLLMVAHDELPSKVGINVYSESWDRLLGRHTRLANHFTGDYSGFDTSTPRVLVYA IIDKINELADDGEVNQRTRRNIIRFVLNRYLISDGVLYEIHGGTPSGFAPTVMINSVVNE FYLKWSWIGLLKEAGYANQATLYAFHEATEISLYGDDNFVSVATPVASVYNLTTISNFLG RIGVKLGDGAKTGTIKPFIPLEEVDFLKRQFVADSGSTAILCPLKKISIEERLFYVRGGQ DEIAALELNIATALCEAFFHGKEYFSFLEGKIIEAMRKSGVALSRPLPTMESVRAWYMSQ RGNTKIRSPSFEGLGTMSGILNIGLAEARSVGGVACFSGIEFRGRSDDHLMVIPTYIPGG WRTKQQQTYISFVRDSEKMAQVIKRVAHFSTVVATDKSMAYLVAICIAYSRGSISRMEVR CHVQNLKVAEmLLCNQICNFL Protein Names:Recommended name: RNA1 polyprotein Alternative name(s): P1 Cleaved into the following 3 chains: 1. Putative helicase EC= 2. 3.6.4.- Alternative name(s): Putative NTP-binding protein Probable picornain 3C-like protease Short Gene Names: Expression Region:1401-2081 Sequence Info:fµLl length protein

2,054.00 € 2054.0 EUR 2,054.00 €

2,054.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.