ELISA Recombinant Thermotoga maritima Glycerol-3-phosphate acyltransferase 1(plsY1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) Uniprot NO.:Q9X109 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLNFFLITIQFLSGAVMYSHIIAKIKGIDLRKIRDGNPGSSNLWRAAGWKYGFPALmLDY FKGTFPIAFFVWNESFHVNRYVIAFAALSGILGHAFSPFLKFKGGKAIATTFGAWSVLTK WEGPMVLGTVFTIFSILHRLRGKNKTTPEEDAFRVMIGFAALLIYTMWKVFNGMPELAIL YFGNFLIVFYKHRLELRRYLKGV Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys Gene Names:Name:plsY1 Ordered Locus Names:TM_1283 Expression Region:1-203 Sequence Info:fµLl length protein