ELISA Recombinant Pseudoalteromonas phage PM2 Uncharacterized protein Gp-j(j)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudoalteromonas phage PM2 (Bacteriophage PM2) Uniprot NO.:Q9XJR4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLFGGGNSKSTSNQTTNNENTNIATQGDNLGAVINGNGNSVTMTDHGLVDALVDIGGYM SDSTQAAFGAASDMAYSSTEFAGQAITDGFDYAEGVNRDSLDMAEGINRDSLNFGRDALS VTGDLMTDAMQYSSDAmLASIEGNAGLAGQVMDASTTMTGQSLNFGLDTFSGAMDSLNQS NNNMALLAEFTSNQSTDLARDSMAFGADLMAQYQDNISASNYDAREHmLDASKTAMQFAD NMSRSDGQQLAKDSNKTLMIGIVAVSAAVGLYAISKGVN Protein Names:Recommended name: Uncharacterized protein Gp-j Gene Names:ORF Names:j Expression Region:1-279 Sequence Info:fµLl length protein