ELISA Recombinant Streptomyces coelicolor Probable cytochrome c oxidase subunit 3(ctaE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9X809 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVVATATTVETGHAHPSVNRPNLTSVGTIIWLSSELMFFAALFAMYFTLRSVTGPDFWS EKADALNIPFSATNTTILVLSSLTCQLGVFAAERGDVKKLRMWFIVTFVMGAIFIGGQVF EYTELVKHEGISLSSDPYGSAFYLTTGFHGLHVTGGLIAFLLVLGRTYAARRFTHEQATA AIVVSYYWHFVDVVWIGLFATIYLIK Protein Names:Recommended name: Probable cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 3 Cytochrome c oxidase polypeptide III Gene Names:Name:ctaE Ordered Locus Names:SCO2151 ORF Names:SC6G10.24c Expression Region:1-206 Sequence Info:fµLl length protein