ELISA Recombinant Streptomyces coelicolor UPF0060 membrane protein SCO3297(SCO3297)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9X889 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLVLRSAALFVVAALFEIGGAWLVWQGVREQRGWLWAAGGVLALGAYGFVATFQPDAHFG RILAAYGGIFVTGSILWGVVADGYRPDRWDIAGALVCLAGMALIMWAPRNGG Protein Names:Recommended name: UPF0060 membrane protein SCO3297 Gene Names:Ordered Locus Names:SCO3297 ORF Names:SCE15.14 Expression Region:1-112 Sequence Info:fµLl length protein