ELISA Recombinant Solute carrier family 2, facilitated glucose transporter member 4(SLC2A4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q9XT10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQG PNGPGSIPPGTLTTLWALSVAIFSVGGMFSSFLLGIISQWLGRKKAmLFNNTLAVLAGAL MGLAKAAASYEmLILGRFLIGAYSGLASGLVPMYVGEIAPTHLRGALGTLNQLA Protein Names:Recommended name: Solute carrier family 2, facilitated glucose transporter member 4 Alternative name(s): Glucose transporter type 4, insµLin-responsive Short name= GLUT-4 Gene Names:Name:SLC2A4 Synonyms:GLUT4 Expression Region:1-174 Sequence Info:fµLl length protein