ELISA Recombinant Pyrococcus abyssi Probable cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pyrococcus abyssi (strain GE5 / Orsay) Uniprot NO.:Q9V2M8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPLILLGLALIWDLLLGEPPAKIHPVVWFGKIAGFLDNRWRRRGKIGFLAGAFVTFIIV ALAFFLSLIPSYLTFPLDYLLAIYLLKSSFAIRSLYEHVARTVTEDIEEKRKTVSMIVSR DVKVLDLAHLNSAAIESLAENLNDSVVAPLFYFmLFGLPGAMVYRAVNTLDAMFGYRDER YEYFGKFPARLDDILNFIPARLTVLLYLPFGVKVLKYYKLARFKINSDKPIAAMSAVLGV WLEKPGAYRFPGREPRDEDIKRALDVYKLVVAEYLSIVFVLKVVQLCLNP Protein Names:Recommended name: Probable cobalamin biosynthesis protein CobD Gene Names:Name:cobD Synonyms:cbib Ordered Locus Names:PYRAB00470 ORF Names:PAB0025 Expression Region:1-290 Sequence Info:fµLl length protein