ELISA Recombinant Vitreoscilla sp. Probable intracellular septation protein A

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vitreoscilla sp. (strain C1) Uniprot NO.:Q9XD50 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNAKTLDAIKPFLDWIPLIVFFYIYKTTEGEGSEHIIAATTGLLIATLIVYGLMFVLQKF TLEKRQWLVVVLTVVFGGLTMAFQDDFYIRLKAPIINAVFAFGLAMSPLFLGGTPGIQKM LGPIFEMTPKQWMKLNWVWVGFFTLMAVLQALFAFVWVEYWAMFTAFGDMIVMVVFMVAQ FWFLRGFMRKDIK Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names: Expression Region:1-193 Sequence Info:fµLl length protein