ELISA Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000(PYRAB02000)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pyrococcus abyssi (strain GE5 / Orsay) Uniprot NO.:Q9V274 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLQEILSSALLmLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANIIGFLLLLIFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALESGGMVTIKKEKNILALAAVPVATPLIAGP AAITAAITLTAEYGIVVSVTATFIAIVITAVLmLLSLYLMRGINKTALSVTIRIIGLFIM AIGAQMMISGAGGIVLSILKEA Protein Names:Recommended name: UPF0056 membrane protein PYRAB02000 Gene Names:Ordered Locus Names:PYRAB02000 ORF Names:PAB2220 Expression Region:1-202 Sequence Info:fµLl length protein