Skip to Content

ELISA Recombinant Thermotoga maritima Methyl-accepting chemotaxis protein 2(mcp2)

https://www.anagnostics.com/web/image/product.template/159924/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) Uniprot NO.:Q9X0M7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLKGKTLLVSTITLAAVVLVALLGGSVFLKAGQNVRKAFEEYELAVEALDKLGELETKV ALFVNNAAKIEEVSSLFNELKKVADKIPSLKEHMDALERNISEIISGKTEVVSRIQSSVD QVKEDIMANLDRTRENLDKEISYSSELIRNVLFIVLPIVAVASGVFLFVMISRSLRLLKP VMEASRSLRNNDLTINIQEAKGKDEISTLLNEFKASIEYLRNNLKDVQTETFSVAESIEE ISKANEEITNQLLGISKEMDNISTRIESISASVQETTAGSEEISSATKNIADSAQQAASF ADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQT NLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVS SEITARVEEGTKLADEADEKLNSIVGAVERINEmLQNIAAAIEEQTAAVDEITTAMTENA KNAEEITNSVKEVNARLQEISASTEEVTSRVQTIRENVQmLKEIVARYKI Protein Names:Recommended name: Methyl-accepting chemotaxis protein 2 Gene Names:Name:mcp2 Ordered Locus Names:TM_1143 Expression Region:1-530 Sequence Info:fµLl length protein

1,894.00 € 1894.0 EUR 1,894.00 €

1,894.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.