ELISA Recombinant Streptomyces coelicolor Probable cytochrome c oxidase subunit 2(ctaC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9X814 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CTYEDFPRLGMPTPTTEEAPRILSLWQGSWAAALATGVLVWGLILWSVFFHRRSRTKVEV PPQTRYNLPIEALYTMVPLVIVSVLFYFTARDESDLMSLNKKPDLTVNVVGFQWSWCFNH IEDVPGSTGDAKTSKELAGIPDRFIEDFPANAGGVYDCGTPGTENPQTGNPGPTLWLPKG KTVRFVLTSRDVIHSFWVVPFLMKQDVIPGHTNAFEVTPNKEGTFLGKCAELCGVDHSRM LFNVKVVSPERYEQHLQDLAKKGQTGYVPAGIAQTSHEKNRETNNL Protein Names:Recommended name: Probable cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome aa3 subunit 2 Cytochrome c oxidase polypeptide II Mtb92 Gene Names:Name:ctaC Ordered Locus Names:SCO2156 ORF Names:SC6G10.29c Expression Region:34-319 Sequence Info:fµLl length protein