ELISA Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanosarcina barkeri (strain Fusaro / DSM 804) Uniprot NO.:Q9Y8K6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDGKAPAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLL FLIYTVVSSMFM Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit G EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G Gene Names:Name:mtrG Ordered Locus Names:Mbar_A1256 Expression Region:1-72 Sequence Info:fµLl length protein