ELISA Recombinant Xenopus laevis C-X-C chemokine receptor type 4-A(cxcr4-a)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q9YGC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDGFSGGIDINIFDGNSTENGSGDFEDFIEPCFMHENSDFNRIFLPTIYSFIFLLGIIGN GLVVVVMGYQKKSRTMTDKYRLHLSVADLLFVFTLPFWSVDAAIGWYFKEFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQGSRKmLADKVVYAGVWLPALLLTVPDLVFAR VSDENGQFVCDRIYPIENRETWTVGFRFLHITVGLILPGLIILICYCVIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVCLTTDTFmLLGLVKGDCIWENTLHMAISITEALAFF HCCLNPILYAFLGAKFKTSAQNAFTSVSRGSSLKILSKKRAGLSSVSTESESSSFHSS
Protein Names:Recommended name: C-X-C chemokine receptor type 4-A Short name= CXC-R4-A Short name= CXCR-4-A Short name= xCXCR4 Alternative name(s): Stromal cell-derived factor 1 receptor A Short name= SDF-1 receptor A
Gene Names:Name:cxcr4-a Synonyms:cxcr4
Expression Region:1-358
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.