Skip to Content

ELISA Recombinant Xenopus laevis C-X-C chemokine receptor type 4-A(cxcr4-a)

https://www.anagnostics.com/web/image/product.template/161133/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q9YGC3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDGFSGGIDINIFDGNSTENGSGDFEDFIEPCFMHENSDFNRIFLPTIYSFIFLLGIIGN GLVVVVMGYQKKSRTMTDKYRLHLSVADLLFVFTLPFWSVDAAIGWYFKEFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQGSRKmLADKVVYAGVWLPALLLTVPDLVFAR VSDENGQFVCDRIYPIENRETWTVGFRFLHITVGLILPGLIILICYCVIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVCLTTDTFmLLGLVKGDCIWENTLHMAISITEALAFF HCCLNPILYAFLGAKFKTSAQNAFTSVSRGSSLKILSKKRAGLSSVSTESESSSFHSS Protein Names:Recommended name: C-X-C chemokine receptor type 4-A Short name= CXC-R4-A Short name= CXCR-4-A Short name= xCXCR4 Alternative name(s): Stromal cell-derived factor 1 receptor A Short name= SDF-1 receptor A Gene Names:Name:cxcr4-a Synonyms:cxcr4 Expression Region:1-358 Sequence Info:fµLl length protein

1,713.00 € 1713.0 EUR 1,713.00 €

1,713.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.