Skip to Content

ELISA Recombinant Rat Osteocalcin(Bglap)

https://www.anagnostics.com/web/image/product.template/152687/image_1920?unique=e16ca1f
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P04640 Gene Names: Bglap Organism: Rattus norvegicus (Rat) AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV Expression Region: 50-99aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 32.6 kDa Alternative Name(s): Bone Gla protein ;BGPGamma-carboxyglutamic acid-containing protein Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Reference: Structure of the rat osteocalcin gene and regµLation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.