Skip to Content

ELISA Recombinant Rat Carbonic anhydrase 1(Ca1)

https://www.anagnostics.com/web/image/product.template/152059/image_1920?unique=5e1ca23
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: B0BNN3 Gene Names: Ca1 Organism: Rattus norvegicus (Rat) AA Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF Expression Region: 2-261aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 44.2 kDa Alternative Name(s): Carbonate dehydratase I Relevance: Reversible hydration of carbon dioxide.Curated Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bµLb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.