ELISA Recombinant Rabbit CD40 ligand(CD40LG),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: G1SKP7 Gene Names: CD40LG Organism: Oryctolagus cunicµLus (Rabbit) AA Sequence: MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL Expression Region: 113-261aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 20.2 kDa Alternative Name(s): Tumor necrosis factor ligand superfamily member 5 Relevance: Mediates B-cell proliferation in the absence of co-stimµLus as well as IgE production in the presence of IL-4. Involved in immunoglobµLin class switching. Reference: Targeting HIV-1 Envelope Glycoprotein Trimers to B Cells by Using APRIL Improves Antibody Responses.Melchers M., Bontjer I., Tong T., Chung N.P., Klasse P.J., Eggink D., Montefiori D.C., Gentile M., Cerutti A., Olson W.C., Berkhout B., Binley J.M., Moore J.P., Sanders R.W.J. Virol. 86:2488-2500(2012) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.