ELISA Recombinant Rat Carboxypeptidase A1(Cpa1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Signal Transduction Uniprot ID: P00731 Gene Names: Cpa1 Organism: Rattus norvegicus (Rat) AA Sequence: ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY Expression Region: 111-419aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 39.6 kDa Alternative Name(s): Cpa Relevance: Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Reference: "Rat preprocarboxypeptidase A: cDNA sequence and preliminary characterization of the gene." Quinto C., Quiroga M., Swain W.F., Nikovits W.C. Jr., Standring D.N., Pictet R.L., Valenzuela P., Rutter W.J. Proc. Natl. Acad. Sci. U.S.A. 79:31-35(1982) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.