ELISA Recombinant Rabbit Cathepsin K(Ctsk)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P43236 Gene Names: Ctsk Organism: Oryctolagus cunicµLus (Rabbit) AA Sequence: TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM Expression Region: 115-329aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 27.6 kDa Alternative Name(s): Protein OC-2 Relevance: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in ExtracellµLar domain matrix degradation. Reference: Beta-substituted cyclohexanecarboxamide a nonpeptidic framework for the design of potent inhibitors of cathepsin K.Crane S.N., Black W.C., Palmer J.T., Davis D.E., Setti E., Robichaud J., Paquet J., Oballa R.M., Bayly C.I., McKay D.J., Somoza J.R., Chauret N., Seto C., Scheigetz J., Wesolowski G., Masse F., Desmarais S., Ouellet M.J. Med. Chem. 49:1066-1079(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.