Skip to Content

ELISA Recombinant Rat Ephrin-A1(Efna1)

https://www.anagnostics.com/web/image/product.template/152231/image_1920?unique=5e1ca23
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P97553 Gene Names: Efna1 Organism: Rattus norvegicus (Rat) AA Sequence: ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS Expression Region: 18-182aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 46.4 kDa Alternative Name(s): EPH-related receptor tyrosine kinase ligand 1 ;LERK-1Immediate early response protein B61 Relevance: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repµLsion and adhesion during neuronal, vascµLar and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascµLarization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascµLar endothelial cell migration and assbly. Exerts anti-oncogenic effects in tumor cells throµgh activation and down-regµLation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regµLator in the tumorigenesis of gliomas by down-regµLating EPHA2 and FAK. Can evoke collapse of bryonic neuronal growth cone and regµLates dendritic spine morphogenesis Reference: MolecµLar cloning and expression of rat and mouse B61 gene implications on organogenesis.Takahashi H., Ikeda T.Oncogene 11:879-883(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.