Skip to Content

ELISA Recombinant Sheep Somatoliberin(GHRH)

https://www.anagnostics.com/web/image/product.template/156789/image_1920?unique=263afdf
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P07217 Gene Names: GHRH Organism: Ovis aries (Sheep) AA Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL Expression Region: 1-44aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 32.1 kDa Alternative Name(s): Growth hormone-releasing factor ;GRFGrowth hormone-releasing hormone ;GHRH Relevance: GRF is released by the hypothalamus and acts on the adenohypophyse to stimµLate the secretion of growth hormone. Reference: Growth hormone-releasing factor from ovine and caprine hypothalamus isolation, sequence analysis and total synthesis.Brazeau P., Boehlen P., Esch F., Ling N., Wehrenberg W.B., Guillemin R.Biochem. Biophys. Res. Commun. 125:606-614(1984) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.