ELISA Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P00502 Gene Names: Gsta1 Organism: Rattus norvegicus (Rat) AA Sequence: SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF Expression Region: 2-222aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 41.5 kDa Alternative Name(s): GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;Ligandin Relevance: Conjµgation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Reference: Localization of the C-terminus of rat glutathione S-transferase A1-1 crystal structure of mutants W21F and W21F/F220Y.Adman E.T., Le Trong I., Stenkamp R.E., Nieslanik B.S., Dietze E.C., Tai G., Ibarra C., Atkins W.M.3.0.CO;2-%23>Proteins 42:192-200(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.