ELISA Recombinant Sheep Interleukin-1 beta(IL1B)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Others Uniprot ID: P21621 Gene Names: IL1B Organism: Ovis aries (Sheep) AA Sequence: AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP Expression Region: 114-266aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 21.7 kDa Alternative Name(s): Relevance: Produced by activated macrophages, IL-1 stimµLates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimµLate the release of prostaglandin and collagenase from synovial cells. Reference: MolecµLar cloning and characterization of ovine IL-1 alpha and IL-1 beta.Andrews A.E., Barcham G.J., Brandon M.R., Nash A.D.Immunology 74:453-460(1991) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.