ELISA Recombinant Sus scrofa Interleukin-33(IL33),partial
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: IL33
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Sus scrofa (Pig)
Delivery time: 3-7 business days
Uniprot ID: M5B263
AA Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
Tag info: N-terminal GST-tagged
Expression Region: 123-276aa
Protein length: Partial
MW: 44.6 kDa
Alternative Name(s):
Relevance:
Reference: "cDNA cloning and expression of porcine IL-33."Shimazu T., Tohno M., Kawai Y., Saito T., Kitazawa H.Submitted (FEB-2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.