ELISA Recombinant Sus scrofa Interleukin-33(IL33),partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Others Target / Protein: IL33 Biologically active: Not Tested Expression system: E.coli Species of origin: Sus scrofa (Pig) Delivery time: 3-7 business days Uniprot ID: M5B263 AA Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM Tag info: N-terminal GST-tagged Expression Region: 123-276aa Protein length: Partial MW: 44.6 kDa Alternative Name(s): Relevance: Reference: "cDNA cloning and expression of porcine IL-33."Shimazu T., Tohno M., Kawai Y., Saito T., Kitazawa H.Submitted (FEB-2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.