ELISA Recombinant Sheep Interleukin-4(IL4)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Immunology Uniprot ID: P30368 Gene Names: IL4 Organism: Ovis aries (Sheep) AA Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC Expression Region: 25-135aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged MW: 29.6 kDa Alternative Name(s): B-cell stimµLatory factor 1 Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimµLator of DNA-synthesis. It induces the expression of class II MHC molecµLes on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regµLates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regµLates IL31RA expression in macrophages. Reference: "Cloning and sequencing an ovine interleukin-4-encoding cDNA."Seow H.F., Rothel J.S., Wood P.R.Gene 124:291-293(1993) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.