ELISA Recombinant Sheep Interleukin-8(IL8)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P36925 Gene Names: IL8 Organism: Ovis aries (Sheep) AA Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP Expression Region: 23-101aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 13.1 kDa Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8 Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimµLus. Reference: Sequencing of the ovine interleukin-8-encoding cDNA using the polymerase chain reaction.Legastelois I., Greenland T., Arnaud P., Mornex J.F., Cordier G.Gene 150:367-369(1994) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.