ELISA Recombinant Rat Potassium voltage-gated channel subfamily E member 2(Kcne2)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P63161 Gene Names: Kcne2 Organism: Rattus norvegicus (Rat) AA Sequence: MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP Expression Region: 1-123aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 18.4 kDa Alternative Name(s): MinK-related peptide 1Minimum potassium ion channel-related peptide 1;Potassium channel subunit beta MiRP1 Relevance: Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. ModµLates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modµLate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current Reference: MinK-related peptide 1 a beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.Yu H., Wu J., Potapova I., Wymore R.T., Holmes B., Zuckerman J., Pan Z., Wang H., Shi W., Robinson R.B., El-Maghrabi M.R., Benjamin W., Dixon J.E., McKinnon D., Cohen I.S., Wymore R.Circ. Res. 88:E84-E87(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.