ELISA Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P49616 Gene Names: Plaur Organism: Rattus norvegicus (Rat) AA Sequence: LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGP Expression Region: 1-178aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 23.9 kDa Alternative Name(s): CD87 Relevance: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. Reference: The receptor for the plasminogen activator of urokinase type is up-regµLated in transformed rat thyroid cells.Ragno P., Cassano S., Degen J., Kessler C., Blasi F., Rossi G.FEBS Lett. 306:193-198(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.