ELISA Recombinant Rat Regenerating islet-derived protein 3-alpha(Reg3a)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P35231
Gene Names: Reg3a
Organism: Rattus norvegicus (Rat)
AA Sequence: EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ
Expression Region: 26-174aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 20.5 kDa
Alternative Name(s): Islet of Langerhans regenerating protein 3 ;REG 3Lithostathine 3;Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha ;Reg III-alpha
Relevance: Bactericidal C-type lectin. RegµLates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway
Reference: Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis.Frigerio J.-M., Dusetti N.J., Keim V., Dagorn J.-C., Iovanna J.L.Biochemistry 32:9236-9241(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.