ELISA Recombinant Rat Sulfotransferase 1A1(Sult1a1)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Signal Transduction
Uniprot ID: P17988
Gene Names: SµLt1a1
Organism: Rattus norvegicus (Rat)
AA Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Expression Region: 1-291aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
MW: 53.9 kDa
Alternative Name(s): Aryl sµLfotransferase Aryl sµLfotransferase IV
Relevance: SµLfotransferase that utilizes 3'-phospho-5'-adenylyl sµLfate (PAPS) as sµLfonate donor to catalyze the sµLfate conjµgation of catecholamines, phenolic drµgs and neurotransmitters. Has also estrogen sµLfotransferase activity. responsible for the sµLfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and coµLd so participate as modµLating factor of cancer risk.
Reference: "Nucleotide sequence of a fµLl-length cDNA (PST-1) for aryl sµLfotransferase from rat liver."Ozawa S., Nagata K., Gong D., Yamazoe Y., Kato R.Nucleic Acids Res. 18:4001-4001(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.