Skip to Content

ELISA Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

https://www.anagnostics.com/web/image/product.template/151623/image_1920?unique=5e1ca23
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P19761 Gene Names: TFPI Organism: Oryctolagus cunicµLus (Rabbit) AA Sequence: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT Expression Region: 25-300a Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 35.8 kDa Alternative Name(s): Extrinsic pathway inhibitor ;EPILipoprotein-associated coagµLation inhibitor ;LACI Relevance: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. Reference: cDNA sequence of rabbit lipoprotein-associated coagµLation inhibitor.Wesselschmidt R.L., Girard T.J., Broze G.J. Jr.Nucleic Acids Res. 18:6440-6440(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.