ELISA Recombinant Rat Vesicle-associated membrane protein 2(Vamp2),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Cancer Uniprot ID: P63045 Gene Names: Vamp2 Organism: Rattus norvegicus (Rat) AA Sequence: SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK Expression Region: 2-94aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 14.1 kDa Alternative Name(s): Relevance: Involved in the targeting and/or fusion of transport vesicles to their target membrane. ModµLates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 Reference: "Two vesicle-associated membrane protein genes are differentially expressed in the rat central nervous system." Elferink L.A., Trimble W.S., Scheller R.H. J. Biol. Chem. 264:11061-11064(1989) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.