ELISA Recombinant Triticum aestivum Non-specific lipid-transfer protein

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P24296 Gene Names: N/A Organism: Triticum aestivum (Wheat) AA Sequence: DCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV Expression Region: 25-113aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 25.5 kDa Alternative Name(s): Phospholipid transfer protein Short name: PLTP Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Reference: "Nucleotide sequence of a cDNA encoding a lipid transfer protein from wheat (Triticum durum Desf.)."Dieryck W., Gautier M.-F., LµLlien V., Joudrier P.Plant Mol. Biol. 19:707-709(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.