ELISA Recombinant Prunus dulcis x Prunus persica Putative allergen Pru p 1.01(Pru p 1.01)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Allergen Uniprot ID: B6CQR8 Gene Names: Pru p 1.01 Organism: Prunus dµLcis x Prunus persica AA Sequence: MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN Expression Region: 1-160aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 33.6 kDa Alternative Name(s): Relevance: Reference: "Genomic characterization of putative allergen genes in peach/almond and their synteny with apple."Chen L., Zhang S., Illa E., Song L., Wu S., Howad W., Arus P., van de Weg E., Chen K., Gao Z.BMC Genomics 9:543-543(2008) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.