ELISA Recombinant Tenebrio molitor Larval cuticle protein A1A

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P80681 Gene Names: N/A Organism: Tenebrio molitor (Yellow mealworm beetle) AA Sequence: GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH Expression Region: 1-174aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged MW: 24.7 kDa Alternative Name(s): TM-LCP A1A Short name: TM-A1A Relevance: Component of the cuticle of the larva of Tenebrio molitor Reference: "Sequence studies of proteins from larval and pupal cuticle of the yellow meal worm, Tenebrio molitor."Andersen S.O., Rafn K., Roepstorff P.Insect Biochem. Mol. Biol. 27:121-131(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.